GUCY2D Antibody (6D9)

Images

 
Sandwich ELISA: GUCY2D Antibody (6D9) [H00003000-M02] - Detection limit for recombinant GST tagged GUCY2D is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related GUCY2D Primary Antibodies

Order Details


    • Catalog Number
      H00003000-M02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GUCY2D Antibody (6D9) Summary

Immunogen
GUCY2D (NP_000171, 521 a.a. - 630 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKLQELRHENVALYLGLFLARGAEGPAALWEGNLAVVSEHCTRGSLQDL
Specificity
GUCY2D - guanylate cyclase 2D, membrane (retina-specific)
Isotype
IgG
Clonality
Monoclonal
Host
Mouse
Gene
GUCY2D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GUCY2D Antibody (6D9)

  • CORD6cone rod dystrophy 5/6
  • CYGD
  • EC 4.6.1
  • guanylate cyclase 2D, membrane (retina-specific)
  • Guanylate cyclase 2D, retinal
  • GUC1A4
  • GUC2DCORD5
  • LCA
  • LCA1RCD2
  • retGC
  • RETGC1
  • RETGC-1EC 4.6.1.2
  • retinal guanylyl cyclase 1
  • Rod outer segment membrane guanylate cyclase
  • ROSGC
  • ROS-GC
  • ROS-GC1

Background

This gene encodes a retina-specific guanylate cyclase, which is a member of the membrane guanylyl cyclase family. Like other membrane guanylyl cyclases, this enzyme has a hydrophobic amino-terminal signal sequence followed by a large extracellular domain, a single membrane spanning domain, a kinase homology domain, and a guanylyl cyclase catalytic domain. In contrast to other membrane guanylyl cyclases, this enzyme is not activated by natriuretic peptides. Mutations in this gene result in Leber congenital amaurosis and cone-rod dystrophy-6 diseases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00002978-R01V
Species: Hu
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-84856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-683
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M02
Species: Hu
Applications: WB, ELISA

Publications for GUCY2D Antibody (H00003000-M02) (0)

There are no publications for GUCY2D Antibody (H00003000-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUCY2D Antibody (H00003000-M02) (0)

There are no reviews for GUCY2D Antibody (H00003000-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GUCY2D Antibody (H00003000-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GUCY2D Products

Bioinformatics Tool for GUCY2D Antibody (H00003000-M02)

Discover related pathways, diseases and genes to GUCY2D Antibody (H00003000-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GUCY2D Antibody (H00003000-M02)

Discover more about diseases related to GUCY2D Antibody (H00003000-M02).
 

Pathways for GUCY2D Antibody (H00003000-M02)

View related products by pathway.

Research Areas for GUCY2D Antibody (H00003000-M02)

Find related products by research area.

Blogs on GUCY2D

There are no specific blogs for GUCY2D, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GUCY2D Antibody (6D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2D
Entrez
OMIM
Uniprot