GUCY2C Antibody (3D5)

Images

 

Product Details

Summary
Product Discontinued
View other related GUCY2C Primary Antibodies

Order Details


    • Catalog Number
      H00002984-M03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GUCY2C Antibody (3D5) Summary

Immunogen
GUCY2C (NP_004954, 24 a.a. - 133 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL
Specificity
GUCY2C - guanylate cyclase 2C (heat stable enterotoxin receptor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GUCY2C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GUCY2C Antibody (3D5)

  • EC 4.6.1
  • GC-C
  • guanylate cyclase 2C (heat stable enterotoxin receptor)
  • Guanylyl cyclase C
  • GUC2CEC 4.6.1.2
  • heat-stable enterotoxin receptor
  • hSTAR
  • Intestinal guanylate cyclase
  • STARSTA receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
H00002981-T01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87178
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GUCY2C Antibody (H00002984-M03) (0)

There are no publications for GUCY2C Antibody (H00002984-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GUCY2C Antibody (H00002984-M03) (0)

There are no reviews for GUCY2C Antibody (H00002984-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GUCY2C Antibody (H00002984-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GUCY2C Products

Bioinformatics Tool for GUCY2C Antibody (H00002984-M03)

Discover related pathways, diseases and genes to GUCY2C Antibody (H00002984-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GUCY2C Antibody (H00002984-M03)

Discover more about diseases related to GUCY2C Antibody (H00002984-M03).
 

Pathways for GUCY2C Antibody (H00002984-M03)

View related products by pathway.

PTMs for GUCY2C Antibody (H00002984-M03)

Learn more about PTMs related to GUCY2C Antibody (H00002984-M03).
 

Research Areas for GUCY2C Antibody (H00002984-M03)

Find related products by research area.

Blogs on GUCY2C

There are no specific blogs for GUCY2C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GUCY2C Antibody (3D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2C
Entrez
OMIM
Uniprot