Guanylate kinase Antibody

Images

 
Western Blot: Guanylate kinase Antibody [NBP1-52886] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Guanylate kinase Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52886
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Guanylate kinase Antibody Summary

Immunogen
Synthetic peptides corresponding to GUK1(guanylate kinase 1) The peptide sequence was selected from the middle region of GUK1. Peptide sequence IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI.
Clonality
Polyclonal
Host
Rabbit
Gene
GUK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GUK1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Guanylate kinase Antibody

  • ATP:GMP Phosphotransferase
  • Deoxyguanylate Kinase
  • EC 2.7.4.8
  • FLJ42686
  • FLJ43710
  • GMK
  • GMP Kinase
  • Guanosine monophosphate Kinase
  • guanylate kinase 1
  • Guanylate Kinase
  • GUK1

Background

GUK1 is essential for recycling GMP and indirectly, cGMP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NB300-546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1200
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
NBP1-52886
Species: Hu
Applications: WB

Publications for Guanylate kinase Antibody (NBP1-52886) (0)

There are no publications for Guanylate kinase Antibody (NBP1-52886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Guanylate kinase Antibody (NBP1-52886) (0)

There are no reviews for Guanylate kinase Antibody (NBP1-52886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Guanylate kinase Antibody (NBP1-52886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Guanylate kinase Products

Bioinformatics Tool for Guanylate kinase Antibody (NBP1-52886)

Discover related pathways, diseases and genes to Guanylate kinase Antibody (NBP1-52886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Guanylate kinase Antibody (NBP1-52886)

Discover more about diseases related to Guanylate kinase Antibody (NBP1-52886).
 

Pathways for Guanylate kinase Antibody (NBP1-52886)

View related products by pathway.

PTMs for Guanylate kinase Antibody (NBP1-52886)

Learn more about PTMs related to Guanylate kinase Antibody (NBP1-52886).

Blogs on Guanylate kinase

There are no specific blogs for Guanylate kinase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Guanylate kinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUK1
Entrez
Uniprot