Recombinant Human GTPBP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GTPBP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-406 of Human GTPBP5 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW

Protein/Peptide Type
Recombinant Protein
Gene
GTPBP5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GTPBP5 Protein

  • dJ1005F21.2
  • FLJ10741
  • GTP binding protein 5 (putative)
  • GTP-binding protein 5 (putative)
  • GTP-binding protein 5
  • MGC29512
  • ObgH1OBGH1
  • Protein obg homolog 1

Background

Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85055
Species: Hu
Applications: WB, IHC, IHC-P
H00026164-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GTPBP5 Recombinant Protein (H00026164-P01) (0)

There are no publications for GTPBP5 Recombinant Protein (H00026164-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTPBP5 Recombinant Protein (H00026164-P01) (0)

There are no reviews for GTPBP5 Recombinant Protein (H00026164-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTPBP5 Recombinant Protein (H00026164-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTPBP5 Products

Bioinformatics Tool for GTPBP5 Recombinant Protein (H00026164-P01)

Discover related pathways, diseases and genes to GTPBP5 Recombinant Protein (H00026164-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTPBP5 Recombinant Protein (H00026164-P01)

Discover more about diseases related to GTPBP5 Recombinant Protein (H00026164-P01).

Blogs on GTPBP5

There are no specific blogs for GTPBP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GTPBP10 Antibody
NBP1-85055
GTPBP5 Antibody
NBP1-91975

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GTPBP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTPBP5