Recombinant Human GTF2H3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GTF2H3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-110 of Human GTF2H3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GTF2H3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GTF2H3 GST (N-Term) Protein

  • Basic transcription factor 2 34 kDa subunit
  • BTF2 p34
  • BTF2
  • General transcription factor IIH polypeptide 3
  • general transcription factor IIH subunit 3
  • general transcription factor IIH, polypeptide 3 (34kD subunit)
  • general transcription factor IIH, polypeptide 3, 34kDa
  • TFB4
  • TFIIH basal transcription factor complex p34 subunit
  • TFIIH

Background

GTF2H3 - general transcription factor IIH, polypeptide 3, 34kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-581
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP2-67719
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-74457
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP3-17973
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GTF2H3 Partial Recombinant Protein (H00002967-Q01) (0)

There are no publications for GTF2H3 Partial Recombinant Protein (H00002967-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H3 Partial Recombinant Protein (H00002967-Q01) (0)

There are no reviews for GTF2H3 Partial Recombinant Protein (H00002967-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GTF2H3 Partial Recombinant Protein (H00002967-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2H3 Products

Bioinformatics Tool for GTF2H3 Partial Recombinant Protein (H00002967-Q01)

Discover related pathways, diseases and genes to GTF2H3 Partial Recombinant Protein (H00002967-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GTF2H3 Partial Recombinant Protein (H00002967-Q01)

Discover more about diseases related to GTF2H3 Partial Recombinant Protein (H00002967-Q01).

Research Areas for GTF2H3 Partial Recombinant Protein (H00002967-Q01)

Find related products by research area.

Blogs on GTF2H3

There are no specific blogs for GTF2H3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GTF2H3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H3