GSTZ1 Antibody (1G12) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GSTZ1 Primary Antibodies

Order Details


    • Catalog Number
      H00002954-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GSTZ1 Antibody (1G12) [PE] Summary

Immunogen
GSTZ1 (NP_665877, 109 a.a. - 216 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Specificity
GSTZ1 (1G12)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTZ1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTZ1 Antibody (1G12) [PE]

  • EC 2.5.1.18
  • EC 5.2.1.2
  • glutathione S-alkyltransferase
  • glutathione S-aralkyltransferase
  • Glutathione S-transferase zeta 1
  • glutathione transferase zeta 1
  • GSTZ1-1maleylacetoacetate isomerase
  • MAAIglutathione S-aryltransferase
  • MAI
  • maleylacetone isomerase
  • MGC2029
  • S-(hydroxyalkyl)glutathione lyase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for GSTZ1 Antibody (H00002954-M01PE) (0)

There are no publications for GSTZ1 Antibody (H00002954-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTZ1 Antibody (H00002954-M01PE) (0)

There are no reviews for GSTZ1 Antibody (H00002954-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTZ1 Antibody (H00002954-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTZ1 Products

Bioinformatics Tool for GSTZ1 Antibody (H00002954-M01PE)

Discover related pathways, diseases and genes to GSTZ1 Antibody (H00002954-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTZ1 Antibody (H00002954-M01PE)

Discover more about diseases related to GSTZ1 Antibody (H00002954-M01PE).
 

Pathways for GSTZ1 Antibody (H00002954-M01PE)

View related products by pathway.

PTMs for GSTZ1 Antibody (H00002954-M01PE)

Learn more about PTMs related to GSTZ1 Antibody (H00002954-M01PE).

Blogs on GSTZ1

There are no specific blogs for GSTZ1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTZ1 Antibody (1G12) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTZ1