GSTT2B Antibody

Images

 
Western Blot: GSTT2B Antibody [NBP1-86186] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: GSTT2B Antibody [NBP1-86186] - Staining of human adrenal gland shows cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GSTT2B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPGAPHR
Specificity
Specificity of human GSTT2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSTT2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GSTT2B Recombinant Protein Antigen (NBP1-86186PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSTT2B Antibody

  • glutathione S-transferase theta 2
  • Glutathione S-Transferase Theta 2B (Gene/Pseudogene)
  • Glutathione S-transferase theta-2B
  • GST class-theta-2
  • GSTT2P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: All-NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002941-D01P
Species: Hu, Mu
Applications: WB, IHC
NBP2-24722
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GSTT2B Antibody (NBP1-86186) (0)

There are no publications for GSTT2B Antibody (NBP1-86186).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTT2B Antibody (NBP1-86186) (0)

There are no reviews for GSTT2B Antibody (NBP1-86186). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSTT2B Antibody (NBP1-86186) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GSTT2B Products

Bioinformatics Tool for GSTT2B Antibody (NBP1-86186)

Discover related pathways, diseases and genes to GSTT2B Antibody (NBP1-86186). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTT2B Antibody (NBP1-86186)

Discover more about diseases related to GSTT2B Antibody (NBP1-86186).
 

Pathways for GSTT2B Antibody (NBP1-86186)

View related products by pathway.

Blogs on GSTT2B

There are no specific blogs for GSTT2B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTT2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTT2B