GSTM2 Antibody (1E10.) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related GSTM2 Primary Antibodies

Order Details


    • Catalog Number
      H00002946-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GSTM2 Antibody (1E10.) [DyLight 488] Summary

Immunogen
GSTM2 (NP_000839, 90 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
Specificity
GSTM2 - glutathione S-transferase M2 (muscle) (1E10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTM2 Antibody (1E10.) [DyLight 488]

  • glutathione S-transferase mu 2 (muscle)
  • MGC117303
  • muscle
  • S-(hydroxyalkyl)glutathione lyase M2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GSTM2 Antibody (H00002946-M03G) (0)

There are no publications for GSTM2 Antibody (H00002946-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTM2 Antibody (H00002946-M03G) (0)

There are no reviews for GSTM2 Antibody (H00002946-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTM2 Antibody (H00002946-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTM2 Products

Bioinformatics Tool for GSTM2 Antibody (H00002946-M03G)

Discover related pathways, diseases and genes to GSTM2 Antibody (H00002946-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTM2 Antibody (H00002946-M03G)

Discover more about diseases related to GSTM2 Antibody (H00002946-M03G).
 

Pathways for GSTM2 Antibody (H00002946-M03G)

View related products by pathway.

PTMs for GSTM2 Antibody (H00002946-M03G)

Learn more about PTMs related to GSTM2 Antibody (H00002946-M03G).

Blogs on GSTM2

There are no specific blogs for GSTM2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTM2 Antibody (1E10.) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTM2