GSTA2 Antibody (3D4) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GSTA2 Primary Antibodies

Order Details


    • Catalog Number
      H00002939-M05PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GSTA2 Antibody (3D4) [PE] Summary

Immunogen
GSTA2 (AAH02895, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIA
Specificity
GSTA2 - glutathione S-transferase A2 (3D4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTA2 Antibody (3D4) [PE]

  • EC 2.5.1.18
  • glutathione S-aralkyltransferase A2
  • glutathione S-aryltransferase A2
  • glutathione S-transferase 2
  • glutathione S-transferase A2
  • glutathione S-transferase alpha 2
  • GST class-alpha member 2
  • GST HA subunit 2
  • GST, class alpha, 2
  • GST2glutathione S-alkyltransferase A2
  • GSTA2-2
  • GST-gamma
  • GTA2
  • GTH2
  • HA subunit 2
  • liver GST2
  • MGC10525
  • S-(hydroxyalkyl)glutathione lyase A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-47442
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5357
Species: Hu
Applications: WB, IP, Neut
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002939-M05PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GSTA2 Antibody (H00002939-M05PE) (0)

There are no publications for GSTA2 Antibody (H00002939-M05PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSTA2 Antibody (H00002939-M05PE) (0)

There are no reviews for GSTA2 Antibody (H00002939-M05PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTA2 Antibody (H00002939-M05PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTA2 Products

Bioinformatics Tool for GSTA2 Antibody (H00002939-M05PE)

Discover related pathways, diseases and genes to GSTA2 Antibody (H00002939-M05PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTA2 Antibody (H00002939-M05PE)

Discover more about diseases related to GSTA2 Antibody (H00002939-M05PE).
 

Pathways for GSTA2 Antibody (H00002939-M05PE)

View related products by pathway.

PTMs for GSTA2 Antibody (H00002939-M05PE)

Learn more about PTMs related to GSTA2 Antibody (H00002939-M05PE).

Blogs on GSTA2

There are no specific blogs for GSTA2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTA2 Antibody (3D4) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTA2