GSK-3 beta Antibody

Images

 
Western Blot: GSK-3 beta Antibody [NBP1-53084] - Sample Type: Human Fetal Heart Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: GSK-3 beta Antibody [NBP1-53084] - Human Brain, cortex tissue at an antibody concentration of 2.5 ug/ml.
Western Blot: GSK-3 beta Antibody [NBP1-53084] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: GSK-3 beta Antibody [NBP1-53084] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml GSK3B is supported by BioGPS gene expression data to be expressed in HeLa

Product Details

Summary
Product Discontinued
View other related GSK-3 beta Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53084
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GSK-3 beta Antibody Summary

Immunogen
Synthetic peptides corresponding to GSK3B(glycogen synthase kinase 3 beta) The peptide sequence was selected from the C terminal of GSK3B. Peptide sequence AIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNF.
Clonality
Polyclonal
Host
Rabbit
Gene
GSK3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/m
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GSK3B and was validated on Western blot.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GSK-3 beta Antibody

  • EC 2.7.11
  • EC 2.7.11.26
  • glycogen synthase kinase 3 beta
  • glycogen synthase kinase-3 beta
  • GSK3 beta
  • GSK-3 beta
  • GSK3B
  • GSK3beta isoform

Background

Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A) and beta, show a high degree of amino acid homology. GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation.Glycogen synthase kinase-3 (GSK3) is a proline-directed serine-threonine kinase that was initially identified as a phosphorylating and inactivating glycogen synthase. Two isoforms, alpha (GSK3A; MIM 606784) and beta, show a high degree of amino acid homology (Stambolic and Woodgett, 1994 [PubMed 7980435]). GSK3B is involved in energy metabolism, neuronal cell development, and body pattern formation (Plyte et al., 1992 [PubMed 1333807]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53084
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GSK-3 beta Antibody (NBP1-53084) (0)

There are no publications for GSK-3 beta Antibody (NBP1-53084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSK-3 beta Antibody (NBP1-53084) (0)

There are no reviews for GSK-3 beta Antibody (NBP1-53084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GSK-3 beta Antibody (NBP1-53084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSK-3 beta Products

Bioinformatics Tool for GSK-3 beta Antibody (NBP1-53084)

Discover related pathways, diseases and genes to GSK-3 beta Antibody (NBP1-53084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSK-3 beta Antibody (NBP1-53084)

Discover more about diseases related to GSK-3 beta Antibody (NBP1-53084).
 

Pathways for GSK-3 beta Antibody (NBP1-53084)

View related products by pathway.

PTMs for GSK-3 beta Antibody (NBP1-53084)

Learn more about PTMs related to GSK-3 beta Antibody (NBP1-53084).
 

Research Areas for GSK-3 beta Antibody (NBP1-53084)

Find related products by research area.

Blogs on GSK-3 beta.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSK-3 beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSK3B
Entrez
Uniprot