Gsh1 Antibody

Images

 
Immunohistochemistry-Paraffin: Gsh1 Antibody [NBP2-14076] Staining of human colon shows strong granular cytoplasmic positivity in glandular cells..

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gsh1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gsh1 Protein (NBP2-14076PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gsh1 Antibody

  • GS homeobox 1
  • GSH1
  • Gsh-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43705
Species: Hu
Applications: WB, ICC/IF, IP
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF2567
Species: Mu
Applications: WB, IHC
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF3254
Species: Hu, Mu, Rt
Applications: WB
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP2-14076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Gsh1 Antibody (NBP2-14076) (0)

There are no publications for Gsh1 Antibody (NBP2-14076).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gsh1 Antibody (NBP2-14076) (0)

There are no reviews for Gsh1 Antibody (NBP2-14076). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Gsh1 Antibody (NBP2-14076) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gsh1 Products

Bioinformatics Tool for Gsh1 Antibody (NBP2-14076)

Discover related pathways, diseases and genes to Gsh1 Antibody (NBP2-14076). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Gsh1 Antibody (NBP2-14076)

View related products by pathway.

Blogs on Gsh1

There are no specific blogs for Gsh1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gsh1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSX1