GSG2 Recombinant Protein Antigen

Images

 
There are currently no images for GSG2 Protein (NBP1-81774PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Binding Activity

Order Details

GSG2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSG2.

Source: E. coli

Amino Acid Sequence: QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81774.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GSG2 Recombinant Protein Antigen

  • EC 2.7.11.1
  • germ cell associated 2 (haspin)
  • Germ cell-specific gene 2 protein
  • Haploid germ cell-specific nuclear protein kinase
  • haspin
  • H-haspin
  • serine/threonine-protein kinase haspin

Background

Hapsin is a serine-threonine protein kinase that was originally identified as a cDNA expressed specifically in mouse testicular germ cells. Haspin associates with the chromosomes, centrosomes, and spindle and is critical for proper chromosome alignment and segregation. Haspin is responsible for the phosphorylation of histone H3 at threonine 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
H00011004-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
AF370
Species: Hu
Applications: IP, WB
NBP2-92632
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-37471
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
7268-CT
Species: Hu
Applications: BA
MAB5408
Species: Hu, Rt
Applications: IHC, WB
NBP1-89951
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-87904
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81774PEP
Species: Hu
Applications: Binding Activity

Publications for GSG2 Protein (NBP1-81774PEP) (0)

There are no publications for GSG2 Protein (NBP1-81774PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GSG2 Protein (NBP1-81774PEP) (0)

There are no reviews for GSG2 Protein (NBP1-81774PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GSG2 Protein (NBP1-81774PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GSG2 Products

Bioinformatics Tool for GSG2 Protein (NBP1-81774PEP)

Discover related pathways, diseases and genes to GSG2 Protein (NBP1-81774PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSG2 Protein (NBP1-81774PEP)

Discover more about diseases related to GSG2 Protein (NBP1-81774PEP).
 

Pathways for GSG2 Protein (NBP1-81774PEP)

View related products by pathway.

PTMs for GSG2 Protein (NBP1-81774PEP)

Learn more about PTMs related to GSG2 Protein (NBP1-81774PEP).
 

Research Areas for GSG2 Protein (NBP1-81774PEP)

Find related products by research area.

Blogs on GSG2

There are no specific blogs for GSG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GSG2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GSG2