GRK1 Antibody

Images

 
Western Blot: GRK1 Antibody [NBP1-69079] - Jurkat Whole Cell, concentration 1 ug/ml.

Product Details

Summary
Product Discontinued
View other related GRK1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69079
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GRK1 Antibody Summary

Immunogen
Synthetic peptides corresponding to GRK1 (G protein-coupled receptor kinase 1) The peptide sequence was selected from the middle region of GRK1. Peptide sequence NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR.
Clonality
Polyclonal
Host
Rabbit
Gene
GRK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GRK1 and was validated on Western blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRK1 Antibody

  • G protein-coupled receptor kinase 1rhodopsin kinase
  • GPRK1
  • GRK1
  • RHOK
  • RHOKEC 2.7.11
  • RKEC 2.7.11.14

Background

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
H00003208-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GRK1 Antibody (NBP1-69079) (0)

There are no publications for GRK1 Antibody (NBP1-69079).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK1 Antibody (NBP1-69079) (0)

There are no reviews for GRK1 Antibody (NBP1-69079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRK1 Antibody (NBP1-69079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRK1 Products

Bioinformatics Tool for GRK1 Antibody (NBP1-69079)

Discover related pathways, diseases and genes to GRK1 Antibody (NBP1-69079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRK1 Antibody (NBP1-69079)

Discover more about diseases related to GRK1 Antibody (NBP1-69079).
 

Pathways for GRK1 Antibody (NBP1-69079)

View related products by pathway.

PTMs for GRK1 Antibody (NBP1-69079)

Learn more about PTMs related to GRK1 Antibody (NBP1-69079).
 

Research Areas for GRK1 Antibody (NBP1-69079)

Find related products by research area.

Blogs on GRK1

There are no specific blogs for GRK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRK1
Entrez