GRID1 Antibody

Images

 
There are currently no images for GRID1 Antibody (H00002894-A01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GRID1 Antibody Summary

Immunogen
GRID1 (NP_060021, 349 a.a. - 441 a.a.) partial recombinant protein with GST tag. LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Specificity
GRID1 - glutamate receptor, ionotropic, delta 1
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GRID1
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Publications
Read Publication using H00002894-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GRID1 Antibody

  • GluD1
  • GluR Delta-1 Subunit
  • glutamate receptor delta-1 subunit
  • glutamate receptor, ionotropic, delta 1
  • GRID1
  • KIAA1220GluR delta-1 subunit

Background

GRID1 is subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity (Yamazaki et al., 1992 [PubMed 1372507]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8027
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-46489
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00206
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00003033-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-33588
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GRID1 Antibody (H00002894-A01)(1)

Reviews for GRID1 Antibody (H00002894-A01) (0)

There are no reviews for GRID1 Antibody (H00002894-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRID1 Antibody (H00002894-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRID1 Products

Bioinformatics Tool for GRID1 Antibody (H00002894-A01)

Discover related pathways, diseases and genes to GRID1 Antibody (H00002894-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRID1 Antibody (H00002894-A01)

Discover more about diseases related to GRID1 Antibody (H00002894-A01).
 

Pathways for GRID1 Antibody (H00002894-A01)

View related products by pathway.

Research Areas for GRID1 Antibody (H00002894-A01)

Find related products by research area.

Blogs on GRID1

There are no specific blogs for GRID1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRID1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRID1
Entrez
Uniprot