GRHL1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining in human skin and skeletal muscle tissues using NBP1-81321 antibody. Corresponding GRHL1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human esophagus, placenta, skeletal muscle and skin using Anti-GRHL1 antibody NBP1-81321 (A) shows similar protein ...read more
Western Blot: GRHL1 Antibody [NBP1-81321] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GRHL1 Antibody [NBP1-81321] - Staining of human cell line A-431 shows localization to nucleus & the Golgi apparatus. Antibody staining is shown in green.
Western Blot: GRHL1 Antibody [NBP1-81321] - Analysis in human cell line BEWO.
Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human esophagus shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: GRHL1 Antibody [NBP1-81321] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRHL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLPIASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRHL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation (ChIP)
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in CHIP reported in scientific literature (PMID:31932695). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GRHL1 Protein (NBP1-81321PEP)
Publications
Read Publications using
NBP1-81321 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22395315)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRHL1 Antibody

  • grainyhead-like 1 (Drosophila)
  • grainyhead-like protein 1 homolog
  • LBP protein 32
  • MGRLBP-32
  • NH32
  • TFCP2L2
  • Transcription factor CP2-like 2LBP32Mammalian grainyhead
  • Transcription factor LBP-32

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-57087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88552
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-47214
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB300-506
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
NBP2-75468
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for GRHL1 Antibody (NBP1-81321)(3)

Reviews for GRHL1 Antibody (NBP1-81321) (0)

There are no reviews for GRHL1 Antibody (NBP1-81321). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GRHL1 Antibody (NBP1-81321) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRHL1 Products

Bioinformatics Tool for GRHL1 Antibody (NBP1-81321)

Discover related pathways, diseases and genes to GRHL1 Antibody (NBP1-81321). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRHL1 Antibody (NBP1-81321)

Discover more about diseases related to GRHL1 Antibody (NBP1-81321).
 

Pathways for GRHL1 Antibody (NBP1-81321)

View related products by pathway.

PTMs for GRHL1 Antibody (NBP1-81321)

Learn more about PTMs related to GRHL1 Antibody (NBP1-81321).

Blogs on GRHL1

There are no specific blogs for GRHL1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRHL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRHL1