GRASP65 Antibody

Product Discontinued

GRASP65 Antibody Summary

• Immunogen: Synthetic peptides corresponding to GORASP1 (golgi reassembly stacking protein 1, 65kDa) The peptide sequence was selected from the N terminal of GORASP1)(50ug). Peptide sequence PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEV.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (90%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GORASP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against GORASP1 and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 23936490)

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GRASP65 Antibody

• Golgi peripheral membrane protein p65
• Golgi phosphoprotein 5MGC118897
• golgi reassembly stacking protein 1, 65kDa
• Golgi reassembly-stacking protein 1
• Golgi reassembly-stacking protein of 65 kDa
• GRASP65MGC118894
• P6565 kDa

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a membrane protein involved in establishing the stacked structure of the Golgi apparatus. It is a caspase-3 substrate, and cleavage of this encoded protein contributes to Golgi fragmentation in apoptosis. This encoded protein can form a complex with the Golgi matrix protein GOLGA2, and this complex binds to the vesicle docking protein p115. Several alternatively spliced transcript variants of this gene have been identified, but their full-length natures have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GRASP65 Antibody (NBP1-57592)(1)

Publication using NBP1-57592

• Wang J, Chen J, Enns CA, Mayinger P. The First Transmembrane Domain of Lipid Phosphatase SAC1 Promotes Golgi Localization. PLoS One 2013-08-01 [PMID: 23936490] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: GORASP1
• Uniprot:
  • Q9BQQ3(Human)