GRASP1 Antibody

Images

 
Western Blot: GRASP1 Antibody [NBP1-85102] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: human cell line A-431. Lane 5: Human liver ...read more
Immunohistochemistry-Paraffin: GRASP1 Antibody [NBP1-85102] - Staining of human gall bladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GRASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKQCREQHAAELKGKEEELQDVRDQLEQAQEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQERLQDILTNSKSRSGLEELVLSEMNSPSRTQT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GRIPAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GRASP1 Protein (NBP1-85102PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GRASP1 Antibody

  • DKFZp434P0630
  • GRASP1
  • GRASP-1MGC126595
  • GRIP1 associated protein 1
  • GRIP1-associated protein 1
  • GRIPAP1
  • KIAA1167MGC126593
  • MPMGp800B12492Q3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00085329-T01
Species: Hu
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-88108
Species: Hu
Applications: IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-16267
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-93336
Species: Hu
Applications: WB, IP
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
NBP1-85102
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for GRASP1 Antibody (NBP1-85102) (0)

There are no publications for GRASP1 Antibody (NBP1-85102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRASP1 Antibody (NBP1-85102) (0)

There are no reviews for GRASP1 Antibody (NBP1-85102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRASP1 Antibody (NBP1-85102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GRASP1 Products

Bioinformatics Tool for GRASP1 Antibody (NBP1-85102)

Discover related pathways, diseases and genes to GRASP1 Antibody (NBP1-85102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GRASP1 Antibody (NBP1-85102)

Discover more about diseases related to GRASP1 Antibody (NBP1-85102).
 

Pathways for GRASP1 Antibody (NBP1-85102)

View related products by pathway.

PTMs for GRASP1 Antibody (NBP1-85102)

Learn more about PTMs related to GRASP1 Antibody (NBP1-85102).

Blogs on GRASP1

There are no specific blogs for GRASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GRASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIPAP1
Entrez