Recombinant Human Granzyme A Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Granzyme A Peptides and Proteins

Order Details


    • Catalog Number
      H00003001-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Granzyme A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-101 of Human GZMA partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GZMA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Granzyme A Protein

  • CTL Tryptase
  • CTLA3
  • CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease)
  • Cytotoxic T-lymphocyte proteinase 1
  • EC 3.4.21
  • Fragmentin-1
  • granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
  • Granzyme A
  • Granzyme-1
  • GZMA
  • H factor
  • Hanukkah factor
  • HF
  • HFSP
  • HFSPEC 3.4.21.78

Background

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05027
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Granzyme A Partial Recombinant Protein (H00003001-Q01) (0)

There are no publications for Granzyme A Partial Recombinant Protein (H00003001-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Granzyme A Partial Recombinant Protein (H00003001-Q01) (0)

There are no reviews for Granzyme A Partial Recombinant Protein (H00003001-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme A Partial Recombinant Protein (H00003001-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Granzyme A Products

Bioinformatics Tool for Granzyme A Partial Recombinant Protein (H00003001-Q01)

Discover related pathways, diseases and genes to Granzyme A Partial Recombinant Protein (H00003001-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme A Partial Recombinant Protein (H00003001-Q01)

Discover more about diseases related to Granzyme A Partial Recombinant Protein (H00003001-Q01).
 

Pathways for Granzyme A Partial Recombinant Protein (H00003001-Q01)

View related products by pathway.

PTMs for Granzyme A Partial Recombinant Protein (H00003001-Q01)

Learn more about PTMs related to Granzyme A Partial Recombinant Protein (H00003001-Q01).
 

Research Areas for Granzyme A Partial Recombinant Protein (H00003001-Q01)

Find related products by research area.

Blogs on Granzyme A

There are no specific blogs for Granzyme A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Granzyme A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GZMA
Entrez