Granzyme A Antibody

Product Discontinued

Granzyme A Antibody Summary

• Immunogen: Synthetic peptides corresponding to GZMA(granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)) The peptide sequence was selected from the middle region of GZMA (NP_006135). Peptide sequence TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGT
• Predicted Species: Mouse (100%), Rat (100%), Porcine (100%), Equine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GZMA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against GZMA and was validated on Western blot.
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Granzyme A Antibody

• CTL Tryptase
• CTLA3
• CTLA3Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factorserine protease)
• Cytotoxic T-lymphocyte proteinase 1
• EC 3.4.21
• Fragmentin-1
• granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Granzyme A
• Granzyme-1
• GZMA
• H factor
• Hanukkah factor
• HF
• HFSP
• HFSPEC 3.4.21.78

Background

Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Granzyme A Antibody (NBP1-58993)(1)

Publication using NBP1-58993

• Bem,RA. Pediatr. Res. 63 (6), 650-655. 2008-01-01 [PMID: 18317234]

Bioinformatics

• Gene Symbol: GZMA
• Entrez:
  • 3001(Human)
• Uniprot:
  • P12544(Human)