GR/NR3C1 Antibody (2C8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related GR/NR3C1 Primary Antibodies

Order Details


    • Catalog Number
      H00002908-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GR/NR3C1 Antibody (2C8) [DyLight 488] Summary

Immunogen
NR3C1 (AAH15610, 51 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK
Specificity
NR3C1 - nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR3C1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GR/NR3C1 Antibody (2C8) [DyLight 488]

  • GCR
  • glucocorticoid receptor
  • GR
  • GRGCCR
  • GRLNuclear receptor subfamily 3 group C member 1
  • NR3C1
  • nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
  • nuclear receptor subfamily 3, group C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
7570-GH
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00002908-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GR/NR3C1 Antibody (H00002908-M01G) (0)

There are no publications for GR/NR3C1 Antibody (H00002908-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GR/NR3C1 Antibody (H00002908-M01G) (0)

There are no reviews for GR/NR3C1 Antibody (H00002908-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GR/NR3C1 Antibody (H00002908-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GR/NR3C1 Products

Bioinformatics Tool for GR/NR3C1 Antibody (H00002908-M01G)

Discover related pathways, diseases and genes to GR/NR3C1 Antibody (H00002908-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GR/NR3C1 Antibody (H00002908-M01G)

Discover more about diseases related to GR/NR3C1 Antibody (H00002908-M01G).
 

Pathways for GR/NR3C1 Antibody (H00002908-M01G)

View related products by pathway.

PTMs for GR/NR3C1 Antibody (H00002908-M01G)

Learn more about PTMs related to GR/NR3C1 Antibody (H00002908-M01G).
 

Research Areas for GR/NR3C1 Antibody (H00002908-M01G)

Find related products by research area.

Blogs on GR/NR3C1

There are no specific blogs for GR/NR3C1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GR/NR3C1 Antibody (2C8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol NR3C1
Entrez