GR/NR3C1 Antibody (2C8)

Images

 
Western Blot: GR/NR3C1 Antibody (2C8) [H00002908-M01] - NR3C1 monoclonal antibody (M01), clone 2C8 Analysis of NR3C1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: GR/NR3C1 Antibody (2C8) [H00002908-M01] - Analysis of monoclonal antibody to NR3C1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: GR/NR3C1 Antibody (2C8) [H00002908-M01] - Analysis of NR3C1 expression in transfected 293T cell line by NR3C1 monoclonal antibody (M01), clone 2C8.Lane 1: NR3C1 transfected lysate(85.7 KDa).Lane 2: ...read more
Sandwich ELISA: GR/NR3C1 Antibody (2C8) [H00002908-M01] - Detection limit for recombinant GST tagged NR3C1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GR/NR3C1 Antibody (2C8) Summary

Immunogen
NR3C1 (AAH15610, 51 a.a. - 140 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK
Specificity
NR3C1 - nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NR3C1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GR/NR3C1 Antibody (2C8)

  • GCR
  • glucocorticoid receptor
  • GR
  • GRGCCR
  • GRLNuclear receptor subfamily 3 group C member 1
  • NR3C1
  • nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
  • nuclear receptor subfamily 3, group C, member 1

Background

The protein encoded by this gene is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
7570-GH
Species: Hu
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00002908-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GR/NR3C1 Antibody (H00002908-M01) (0)

There are no publications for GR/NR3C1 Antibody (H00002908-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GR/NR3C1 Antibody (H00002908-M01) (0)

There are no reviews for GR/NR3C1 Antibody (H00002908-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GR/NR3C1 Antibody (H00002908-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GR/NR3C1 Products

Bioinformatics Tool for GR/NR3C1 Antibody (H00002908-M01)

Discover related pathways, diseases and genes to GR/NR3C1 Antibody (H00002908-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GR/NR3C1 Antibody (H00002908-M01)

Discover more about diseases related to GR/NR3C1 Antibody (H00002908-M01).
 

Pathways for GR/NR3C1 Antibody (H00002908-M01)

View related products by pathway.

PTMs for GR/NR3C1 Antibody (H00002908-M01)

Learn more about PTMs related to GR/NR3C1 Antibody (H00002908-M01).
 

Research Areas for GR/NR3C1 Antibody (H00002908-M01)

Find related products by research area.

Blogs on GR/NR3C1

There are no specific blogs for GR/NR3C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GR/NR3C1 Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NR3C1
Entrez
OMIM
Uniprot