GPX8 Antibody

Images

 
Western Blot: GPX8 Antibody [NBP1-83968] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: GPX8 Antibody [NBP1-83968] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related GPX8 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83968
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GPX8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRW
Specificity
Specificity of human GPX8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPX8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPX8 Antibody

  • EC 1.11.1
  • EC 1.11.1.9
  • EPLA847
  • glutathione peroxidase 8 (putative)
  • GPx-8
  • GSHPx-8
  • probable glutathione peroxidase 8
  • UNQ847

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-31474
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-52983
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005555-P01
Species: Hu
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
AF4817
Species: Mu
Applications: WB
NBP1-86614
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-83968
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for GPX8 Antibody (NBP1-83968) (0)

There are no publications for GPX8 Antibody (NBP1-83968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPX8 Antibody (NBP1-83968) (0)

There are no reviews for GPX8 Antibody (NBP1-83968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPX8 Antibody (NBP1-83968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPX8 Products

Bioinformatics Tool for GPX8 Antibody (NBP1-83968)

Discover related pathways, diseases and genes to GPX8 Antibody (NBP1-83968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPX8 Antibody (NBP1-83968)

Discover more about diseases related to GPX8 Antibody (NBP1-83968).

PTMs for GPX8 Antibody (NBP1-83968)

Learn more about PTMs related to GPX8 Antibody (NBP1-83968).

Blogs on GPX8

There are no specific blogs for GPX8, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPX8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPX8