GPX8 Antibody


Western Blot: GPX8 Antibody [NBP1-83968] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: GPX8 Antibody [NBP1-83968] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GPX8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRW
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPX8 Protein (NBP1-83968PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GPX8 Antibody

  • EC 1.11.1
  • EC
  • EPLA847
  • glutathione peroxidase 8 (putative)
  • GPx-8
  • GSHPx-8
  • probable glutathione peroxidase 8
  • UNQ847


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
Species: Mu
Applications: WB
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for GPX8 Antibody (NBP1-83968) (0)

There are no publications for GPX8 Antibody (NBP1-83968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPX8 Antibody (NBP1-83968) (0)

There are no reviews for GPX8 Antibody (NBP1-83968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPX8 Antibody (NBP1-83968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPX8 Products

Bioinformatics Tool for GPX8 Antibody (NBP1-83968)

Discover related pathways, diseases and genes to GPX8 Antibody (NBP1-83968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPX8 Antibody (NBP1-83968)

Discover more about diseases related to GPX8 Antibody (NBP1-83968).

PTMs for GPX8 Antibody (NBP1-83968)

Learn more about PTMs related to GPX8 Antibody (NBP1-83968).

Blogs on GPX8

There are no specific blogs for GPX8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPX8 Antibody and receive a gift card or discount.


Gene Symbol GPX8