GPVI Antibody

Images

 
Western Blot: glycoprotein VI Antibody [NBP1-69476] - This Anti-GP6 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPVI Antibody Summary

Immunogen
Synthetic peptides corresponding to GP6(glycoprotein VI (platelet)) The peptide sequence was selected from the middle region of Glycoprotein VI. Peptide sequence PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GP6 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPVI Antibody

  • Glycoprotein 6
  • glycoprotein VI (platelet)
  • GP6
  • GPIV
  • GPVI
  • GPVIplatelet collagen receptor
  • MGC138168
  • platelet glycoprotein VI

Background

Glycoprotein VI (GP6) is a 58-kD platelet membrane glycoprotein that plays a crucial role in the collagen-induced activation and aggregation of platelets. Collagen receptor involved in collagen-induced platelet adhesion and activation. GP6 plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely Fyn/Lyn), the adapter protein LAT and leads to the activation of phospholipase C gamma2.Glycoprotein VI (GP6) is a 58-kD platelet membrane glycoprotein that plays a crucial role in the collagen-induced activation and aggregation of platelets. Upon injury to the vessel wall and subsequent damage to the endothelial lining, exposure of the subendothelial matrix to blood flow results in deposition of platelets. Collagen fibers are the most thrombogenic macromolecular components of the extracellular matrix, with collagen types I, III, and VI being the major forms found in blood vessels. Platelet interaction with collagen occurs as a 2-step procedure: (1) the initial adhesion to collagen is followed by (2) an activation step leading to platelet secretion, recruitment of additional platelets, and aggregation. In physiologic conditions, the resulting platelet plug is the initial hemostatic event limiting blood loss. However, exposure of collagen after rupture of atherosclerotic plaques is a major stimulus of thrombus formation associated with myocardial infarction or stroke (Jandrot-Perrus et al., 2000 [PubMed 10961879]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-69476
Species: Hu
Applications: WB

Publications for GPVI Antibody (NBP1-69476) (0)

There are no publications for GPVI Antibody (NBP1-69476).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPVI Antibody (NBP1-69476) (0)

There are no reviews for GPVI Antibody (NBP1-69476). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPVI Antibody (NBP1-69476) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPVI Products

Bioinformatics Tool for GPVI Antibody (NBP1-69476)

Discover related pathways, diseases and genes to GPVI Antibody (NBP1-69476). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPVI Antibody (NBP1-69476)

Discover more about diseases related to GPVI Antibody (NBP1-69476).
 

Pathways for GPVI Antibody (NBP1-69476)

View related products by pathway.

PTMs for GPVI Antibody (NBP1-69476)

Learn more about PTMs related to GPVI Antibody (NBP1-69476).

Blogs on GPVI

There are no specific blogs for GPVI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPVI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GP6
Entrez
Uniprot