GPRIN1 Antibody

Images

 
Western Blot: GPRIN1 Antibody [NBP1-83330] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: GPRIN1 Antibody [NBP1-83330] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and plasma membrane.
Immunohistochemistry-Paraffin: GPRIN1 Antibody [NBP1-83330] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Product Discontinued
View other related GPRIN1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83330
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GPRIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSPTCFSPQESPSKETLEAHGASISGTPEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPRIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPRIN1 Antibody

  • G protein regulated inducer of neurite outgrowth 1
  • GRIN1KIAA1893G protein-regulated inducer of neurite outgrowth 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47444
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
36340002
Species: Hu
Applications: WB, ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83330
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPRIN1 Antibody (NBP1-83330) (0)

There are no publications for GPRIN1 Antibody (NBP1-83330).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPRIN1 Antibody (NBP1-83330) (0)

There are no reviews for GPRIN1 Antibody (NBP1-83330). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPRIN1 Antibody (NBP1-83330) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPRIN1 Products

Bioinformatics Tool for GPRIN1 Antibody (NBP1-83330)

Discover related pathways, diseases and genes to GPRIN1 Antibody (NBP1-83330). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRIN1 Antibody (NBP1-83330)

Discover more about diseases related to GPRIN1 Antibody (NBP1-83330).
 

Pathways for GPRIN1 Antibody (NBP1-83330)

View related products by pathway.

PTMs for GPRIN1 Antibody (NBP1-83330)

Learn more about PTMs related to GPRIN1 Antibody (NBP1-83330).

Blogs on GPRIN1

There are no specific blogs for GPRIN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPRIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRIN1