GPR88 Antibody

Images

 
Immunohistochemistry: GPR88 Antibody [NBP2-14071] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related GPR88 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14071
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GPR88 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYR LLRGGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR88
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR88 Antibody

  • G protein coupled receptor 88
  • G protein-coupled receptor 88
  • GPR88
  • G-protein coupled receptor 88
  • probable G-protein coupled receptor 88
  • STRG
  • Striatum-specific G-protein coupled receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NLS418
Species: Hu
Applications: IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
AF482
Species: Mu
Applications: WB, IHC
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for GPR88 Antibody (NBP2-14071) (0)

There are no publications for GPR88 Antibody (NBP2-14071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR88 Antibody (NBP2-14071) (0)

There are no reviews for GPR88 Antibody (NBP2-14071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR88 Antibody (NBP2-14071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR88 Products

GPR88 NBP2-14071

Bioinformatics Tool for GPR88 Antibody (NBP2-14071)

Discover related pathways, diseases and genes to GPR88 Antibody (NBP2-14071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR88 Antibody (NBP2-14071)

Discover more about diseases related to GPR88 Antibody (NBP2-14071).
 

Pathways for GPR88 Antibody (NBP2-14071)

View related products by pathway.

PTMs for GPR88 Antibody (NBP2-14071)

Learn more about PTMs related to GPR88 Antibody (NBP2-14071).
 

Research Areas for GPR88 Antibody (NBP2-14071)

Find related products by research area.

Blogs on GPR88

There are no specific blogs for GPR88, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR88 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR88
Entrez