GPR74/NPFFR2 Antibody

Images

 
Western Blot: NPFFR2 Antibody [NBP1-83336] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-392
Immunocytochemistry/ Immunofluorescence: NPFFR2 Antibody [NBP1-83336] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoskeleton (actin filaments).
Immunohistochemistry-Paraffin: NPFFR2 Antibody [NBP1-83336] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR74/NPFFR2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KYYRVRLNSQNKTSPVYWCREDWPNQEMRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPFFR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR74/NPFFR2 Antibody

  • GPR74
  • GPR74G protein-coupled receptor 74
  • G-protein coupled receptor 74
  • neuropeptide FF 2
  • neuropeptide FF receptor 2
  • Neuropeptide G-protein coupled receptor
  • NPFF2
  • NPFF2G-protein coupled receptor HLWAR77
  • NPFFR2
  • NPGPR
  • NPGPRHLWAR77

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1903
Species: Hu, Po, Bv, Eq, Mk, Pm, Rb
Applications: IHC-P
NBP1-86724
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NLS1922
Species: Hu
Applications: IHC, IHC-P
NBP1-83336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GPR74/NPFFR2 Antibody (NBP1-83336) (0)

There are no publications for GPR74/NPFFR2 Antibody (NBP1-83336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR74/NPFFR2 Antibody (NBP1-83336) (0)

There are no reviews for GPR74/NPFFR2 Antibody (NBP1-83336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GPR74/NPFFR2 Antibody (NBP1-83336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR74/NPFFR2 Products

Bioinformatics Tool for GPR74/NPFFR2 Antibody (NBP1-83336)

Discover related pathways, diseases and genes to GPR74/NPFFR2 Antibody (NBP1-83336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR74/NPFFR2 Antibody (NBP1-83336)

Discover more about diseases related to GPR74/NPFFR2 Antibody (NBP1-83336).
 

Pathways for GPR74/NPFFR2 Antibody (NBP1-83336)

View related products by pathway.

PTMs for GPR74/NPFFR2 Antibody (NBP1-83336)

Learn more about PTMs related to GPR74/NPFFR2 Antibody (NBP1-83336).
 

Research Areas for GPR74/NPFFR2 Antibody (NBP1-83336)

Find related products by research area.

Blogs on GPR74/NPFFR2

There are no specific blogs for GPR74/NPFFR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR74/NPFFR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPFFR2
Entrez