Recombinant Human GPR56 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GPR56 Peptides and Proteins

Order Details


    • Catalog Number
      H00009289-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GPR56 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 31-130 of Human GPR56 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GPR56

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR56 Protein

  • BFPP
  • EGF-TM7-like
  • G protein-coupled receptor 56,7-transmembrane protein with no EGF-like N-terminal domains-1
  • GPR56
  • Protein TM7XN1
  • TM7LN4
  • TM7LN4G-protein coupled receptor 56
  • TM7XN1
  • TM7XN1DKFZp781L1398

Background

GPR56 - G protein-coupled receptor 56

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF7977
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NB120-22104
Species: Hu, Mu, Rt
Applications: WB

Publications for GPR56 Partial Recombinant Protein (H00009289-Q01) (0)

There are no publications for GPR56 Partial Recombinant Protein (H00009289-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR56 Partial Recombinant Protein (H00009289-Q01) (0)

There are no reviews for GPR56 Partial Recombinant Protein (H00009289-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR56 Partial Recombinant Protein (H00009289-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR56 Products

Bioinformatics Tool for GPR56 Partial Recombinant Protein (H00009289-Q01)

Discover related pathways, diseases and genes to GPR56 Partial Recombinant Protein (H00009289-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR56 Partial Recombinant Protein (H00009289-Q01)

Discover more about diseases related to GPR56 Partial Recombinant Protein (H00009289-Q01).
 

Pathways for GPR56 Partial Recombinant Protein (H00009289-Q01)

View related products by pathway.

PTMs for GPR56 Partial Recombinant Protein (H00009289-Q01)

Learn more about PTMs related to GPR56 Partial Recombinant Protein (H00009289-Q01).
 

Research Areas for GPR56 Partial Recombinant Protein (H00009289-Q01)

Find related products by research area.

Blogs on GPR56

There are no specific blogs for GPR56, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR56 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR56
Entrez