GPR56 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR56 Antibody [NBP2-14070] Staining of human colon shows strong cytoplasmic, nuclear and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR56 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASF TFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR56
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GPR56 Protein (NBP2-14070PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR56 Antibody

  • BFPP
  • EGF-TM7-like
  • G protein-coupled receptor 56,7-transmembrane protein with no EGF-like N-terminal domains-1
  • GPR56
  • Protein TM7XN1
  • TM7LN4
  • TM7LN4G-protein coupled receptor 56
  • TM7XN1
  • TM7XN1DKFZp781L1398

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF7977
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NB120-22104
Species: Hu, Mu, Rt
Applications: WB

Publications for GPR56 Antibody (NBP2-14070) (0)

There are no publications for GPR56 Antibody (NBP2-14070).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR56 Antibody (NBP2-14070) (0)

There are no reviews for GPR56 Antibody (NBP2-14070). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR56 Antibody (NBP2-14070) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR56 Products

Bioinformatics Tool for GPR56 Antibody (NBP2-14070)

Discover related pathways, diseases and genes to GPR56 Antibody (NBP2-14070). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR56 Antibody (NBP2-14070)

Discover more about diseases related to GPR56 Antibody (NBP2-14070).
 

Pathways for GPR56 Antibody (NBP2-14070)

View related products by pathway.

PTMs for GPR56 Antibody (NBP2-14070)

Learn more about PTMs related to GPR56 Antibody (NBP2-14070).
 

Research Areas for GPR56 Antibody (NBP2-14070)

Find related products by research area.

Blogs on GPR56

There are no specific blogs for GPR56, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR56 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR56
Entrez