GPR32 Antibody

Images

 
Immunohistochemistry: GPR32 Antibody [NBP1-87526] - Staining of human placenta shows membranous positivity in trophoblastic cells.
Immunohistochemistry: GPR32 Antibody [NBP1-87526] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Summary
Product Discontinued
View other related GPR32 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-87526
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GPR32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIG
Specificity
Specificity of human GPR32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR32 Antibody

  • G protein-coupled receptor 32
  • GPR32
  • probable G-protein coupled receptor 32
  • RVDR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1878
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52023
Species: Hu
Applications: WB, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1317
Species: Hu, Mk, Pm
Applications: Flow, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
MAB362
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-27422
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NLS418
Species: Hu
Applications: IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA

Publications for GPR32 Antibody (NBP1-87526) (0)

There are no publications for GPR32 Antibody (NBP1-87526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR32 Antibody (NBP1-87526) (0)

There are no reviews for GPR32 Antibody (NBP1-87526). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR32 Antibody (NBP1-87526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GPR32 Products

Bioinformatics Tool for GPR32 Antibody (NBP1-87526)

Discover related pathways, diseases and genes to GPR32 Antibody (NBP1-87526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR32 Antibody (NBP1-87526)

Discover more about diseases related to GPR32 Antibody (NBP1-87526).
 

Pathways for GPR32 Antibody (NBP1-87526)

View related products by pathway.

Research Areas for GPR32 Antibody (NBP1-87526)

Find related products by research area.

Blogs on GPR32

There are no specific blogs for GPR32, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR32
Entrez