GPR139 Antibody

Immunohistochemistry: GPR139 Antibody [NBP2-48850] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GPR139 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDK
• Specificity: Specificity of human GPR139 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR139
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GPR139 Recombinant Protein Antigen (NBP2-48850PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR139 Antibody

• G protein-coupled receptor 139
• G(q)-coupled orphan receptor GPRg1
• GPR139
• GPRg1
• G-protein-coupled receptor PGR3
• PGR3
• PGR3G protein-coupled receptor PGR3
• probable G-protein coupled receptor 139

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR139