GPD2 Antibody


Western Blot: GPD2 Antibody [NBP1-69408] - This Anti-GPD2 antibody was used in Western Blot of ACHN tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related GPD2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GPD2 Antibody Summary

Synthetic peptides corresponding to GPD2(glycerol-3-phosphate dehydrogenase 2 (mitochondrial)) The peptide sequence was selected from the middle region of GPD2. Peptide sequence GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GPD2 and was validated on Western blot.
Theoretical MW
81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GPD2 Antibody

  • EC
  • GDH2
  • glycerol-3-phosphate dehydrogenase 2 (mitochondrial)
  • GPDM
  • GPD-M
  • mGPDH
  • mitochondrial glycerophosphate dehydrogenase
  • mitochondrial
  • mtGPD


The protein encoded by this gene localizes to the inner mitochondrial membrane and catalyzes the conversion of glycerol-3-phosphate to dihydroxyacetone phosphate, using FAD as a cofactor. Along with GDP1, the encoded protein constitutes the glycerol phosp


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for GPD2 Antibody (NBP1-69408) (0)

There are no publications for GPD2 Antibody (NBP1-69408).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPD2 Antibody (NBP1-69408) (0)

There are no reviews for GPD2 Antibody (NBP1-69408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPD2 Antibody (NBP1-69408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GPD2 Products

Bioinformatics Tool for GPD2 Antibody (NBP1-69408)

Discover related pathways, diseases and genes to GPD2 Antibody (NBP1-69408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPD2 Antibody (NBP1-69408)

Discover more about diseases related to GPD2 Antibody (NBP1-69408).

Pathways for GPD2 Antibody (NBP1-69408)

View related products by pathway.

PTMs for GPD2 Antibody (NBP1-69408)

Learn more about PTMs related to GPD2 Antibody (NBP1-69408).

Research Areas for GPD2 Antibody (NBP1-69408)

Find related products by research area.

Blogs on GPD2

There are no specific blogs for GPD2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GPD2 Antibody and receive a gift card or discount.


Gene Symbol GPD2