GP1BB Antibody - BSA Free

Images

 
Western Blot: GP1BB Antibody [NBP3-04913] - Analysis of extracts of various cell lines, using GP1BB antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

GP1BB Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 27-147 of human GP1BB (NP_000398.1). PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GP1BB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:200-1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for GP1BB Antibody - BSA Free

  • antigen CD42b-beta
  • BDPLT1
  • BS
  • CD42c
  • glycoprotein Ib (platelet), beta polypeptide
  • glycoprotein Ib platelet beta subunit
  • GP1BB
  • GPIbb
  • GPIbbeta
  • GPIb-Beta
  • nuclear localization signal deleted in velocardiofacial syndrome
  • platelet glycoprotein Ib beta chain
  • platelet membrane glycoprotein Ib beta
  • truncated platelet membrane glycoprotein Ib beta

Background

Platelet glycoprotein Ib (GPIb) is a heterodimeric transmembrane protein consisting of a disulfide-linked 140 kD alphachain and 22 kD beta chain. It is part of the GPIb-V-IX system that constitutes the receptor for von Willebrand factor(VWF), and mediates platelet adhesion in the arterial circulation. GPIb alpha chain provides the VWF binding site, andGPIb beta contributes to surface expression of the receptor and participates in transmembrane signaling throughphosphorylation of its intracellular domain. Mutations in the GPIb beta subunit have been associated withBernard-Soulier syndrome, velocardiofacial syndrome and giant platelet disorder. The 206 amino acid precursor of GPIbbeta is synthesized from a 1.0 kb mRNA expressed in plateletes and megakaryocytes. A 411 amino acid protein arisingfrom a longer, unspliced transcript in endothelial cells has been described; however, the authenticity of this producthas been questioned. Yet another less abundant GPIb beta mRNA species of 3.5 kb, expressed in nonhematopoietic tissuessuch as endothelium, brain and heart, was shown to result from inefficient usage of a non-consensus polyA signalwithin a separate gene (septin 5) located upstream of this gene. In the absence of polyadenylation from its ownimperfect site, the septin 5 gene uses the consensus polyA signal of this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GP1BB Antibody (NBP3-04913) (0)

There are no publications for GP1BB Antibody (NBP3-04913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GP1BB Antibody (NBP3-04913) (0)

There are no reviews for GP1BB Antibody (NBP3-04913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GP1BB Antibody (NBP3-04913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GP1BB Products

Array NBP3-04913

Research Areas for GP1BB Antibody (NBP3-04913)

Find related products by research area.

Blogs on GP1BB

There are no specific blogs for GP1BB, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GP1BB Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GP1BB