gp130/CD130 Antibody (2A4)

Images

 
ELISA: gp130/CD130 Antibody (2A4) [H00003572-M05] - Detection limit for recombinant GST tagged IL6ST is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

gp130/CD130 Antibody (2A4) Summary

Immunogen
IL6ST (NP_002175, 23 a.a. - 122 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Specificity
IL6ST (2A4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL6ST
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using
H00003572-M05 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for gp130/CD130 Antibody (2A4)

  • CD130 antigen
  • CD130
  • CDw130
  • DKFZp564F053
  • gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form
  • gp130
  • IL-6 receptor subunit beta
  • IL-6R subunit beta
  • IL-6RB
  • IL-6R-beta
  • IL6ST
  • interleukin 6 signal transducer (gp130, oncostatin M receptor)
  • interleukin receptor beta chain
  • interleukin-6 receptor subunit beta
  • Interleukin-6 signal transducer
  • Membrane glycoprotein 130
  • membrane glycoprotein gp130
  • Oncostatin-M receptor subunit alpha

Background

The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-249-NA
Species: Hu
Applications: WB, Neut
557-NT/CF
Species: Rt
NBP2-01134
Species: Hu
Applications: WB, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF2988
Species: Mu, Rt
Applications: WB

Publications for gp130/CD130 Antibody (H00003572-M05)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for gp130/CD130 Antibody (H00003572-M05) (0)

There are no reviews for gp130/CD130 Antibody (H00003572-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gp130/CD130 Antibody (H00003572-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional gp130/CD130 Products

Bioinformatics Tool for gp130/CD130 Antibody (H00003572-M05)

Discover related pathways, diseases and genes to gp130/CD130 Antibody (H00003572-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gp130/CD130 Antibody (H00003572-M05)

Discover more about diseases related to gp130/CD130 Antibody (H00003572-M05).
 

Pathways for gp130/CD130 Antibody (H00003572-M05)

View related products by pathway.

PTMs for gp130/CD130 Antibody (H00003572-M05)

Learn more about PTMs related to gp130/CD130 Antibody (H00003572-M05).
 

Research Areas for gp130/CD130 Antibody (H00003572-M05)

Find related products by research area.

Blogs on gp130/CD130

There are no specific blogs for gp130/CD130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our gp130/CD130 Antibody (2A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL6ST
Entrez
OMIM
Uniprot