Goosecoid Antibody

Images

 
Western Blot: Goosecoid Antibody [NBP3-10106] - Western blot analysis of Goosecoid in Mouse Stomach lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Goosecoid Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse Goosecoid (NP_034481.1). Peptide sequence TKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEK
Clonality
Polyclonal
Host
Rabbit
Gene
GSC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Goosecoid Antibody

  • goosecoid homeobox
  • Goosecoid
  • GSC
  • homeobox protein goosecoid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

314-BP/CF
Species: Hu
Applications: BA, BA
NB100-207
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
3218-ND/CF
Species: Hu
Applications: BA
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00007357-M03
Species: Hu
Applications: ELISA, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
758-CN/CF
Species: Mu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF2085
Species: Hu, Mu
Applications: ChIP, ICC, IHC, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-01926
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
423-F8
Species: Hu, Mu
Applications: BA
1845-SH/CF
Species: Hu
Applications: BA
QET00B
Species: Hu
Applications: ELISA
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP3-10106
Species: Mu
Applications: WB

Publications for Goosecoid Antibody (NBP3-10106) (0)

There are no publications for Goosecoid Antibody (NBP3-10106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Goosecoid Antibody (NBP3-10106) (0)

There are no reviews for Goosecoid Antibody (NBP3-10106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Goosecoid Antibody (NBP3-10106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Goosecoid Products

Bioinformatics Tool for Goosecoid Antibody (NBP3-10106)

Discover related pathways, diseases and genes to Goosecoid Antibody (NBP3-10106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Goosecoid Antibody (NBP3-10106)

Discover more about diseases related to Goosecoid Antibody (NBP3-10106).
 

Pathways for Goosecoid Antibody (NBP3-10106)

View related products by pathway.

PTMs for Goosecoid Antibody (NBP3-10106)

Learn more about PTMs related to Goosecoid Antibody (NBP3-10106).

Blogs on Goosecoid

There are no specific blogs for Goosecoid, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Goosecoid Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSC