GOLM1 Recombinant Protein Antigen

Images

 
There are currently no images for GOLM1 Protein (NBP1-88775PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GOLM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLM1.

Source: E.coli

Amino Acid Sequence: GKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88775.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GOLM1 Recombinant Protein Antigen

  • bA379P1.3
  • FLJ23608
  • golgi membrane protein 1
  • Golgi membrane protein GP73
  • Golgi phosphoprotein 2C9orf155
  • golgi protein, 73-kD
  • GOLPH2 FLJ22634
  • GP73 chromosome 9 open reading frame 155
  • PSEC0257

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-87217
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for GOLM1 Protein (NBP1-88775PEP) (0)

There are no publications for GOLM1 Protein (NBP1-88775PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLM1 Protein (NBP1-88775PEP) (0)

There are no reviews for GOLM1 Protein (NBP1-88775PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GOLM1 Protein (NBP1-88775PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GOLM1 Protein (NBP1-88775PEP)

Discover related pathways, diseases and genes to GOLM1 Protein (NBP1-88775PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLM1 Protein (NBP1-88775PEP)

Discover more about diseases related to GOLM1 Protein (NBP1-88775PEP).
 

Pathways for GOLM1 Protein (NBP1-88775PEP)

View related products by pathway.

PTMs for GOLM1 Protein (NBP1-88775PEP)

Learn more about PTMs related to GOLM1 Protein (NBP1-88775PEP).
 

Research Areas for GOLM1 Protein (NBP1-88775PEP)

Find related products by research area.

Blogs on GOLM1

There are no specific blogs for GOLM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GOLM1 Antibody
NBP1-50627

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GOLM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLM1