Recombinant Human GOLM1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GOLM1 Peptides and Proteins

Order Details


    • Catalog Number
      H00051280-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GOLM1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 302-401 of Human GOLM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GOLM1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GOLM1 Protein

  • bA379P1.3
  • FLJ23608
  • golgi membrane protein 1
  • Golgi membrane protein GP73
  • Golgi phosphoprotein 2C9orf155
  • golgi protein, 73-kD
  • GOLPH2 FLJ22634
  • GP73 chromosome 9 open reading frame 155
  • PSEC0257

Background

GOLPH2 - golgi phosphoprotein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-83910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91954
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for GOLM1 Partial Recombinant Protein (H00051280-Q01) (0)

There are no publications for GOLM1 Partial Recombinant Protein (H00051280-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GOLM1 Partial Recombinant Protein (H00051280-Q01) (0)

There are no reviews for GOLM1 Partial Recombinant Protein (H00051280-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GOLM1 Partial Recombinant Protein (H00051280-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GOLM1 Products

Bioinformatics Tool for GOLM1 Partial Recombinant Protein (H00051280-Q01)

Discover related pathways, diseases and genes to GOLM1 Partial Recombinant Protein (H00051280-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GOLM1 Partial Recombinant Protein (H00051280-Q01)

Discover more about diseases related to GOLM1 Partial Recombinant Protein (H00051280-Q01).
 

Pathways for GOLM1 Partial Recombinant Protein (H00051280-Q01)

View related products by pathway.

PTMs for GOLM1 Partial Recombinant Protein (H00051280-Q01)

Learn more about PTMs related to GOLM1 Partial Recombinant Protein (H00051280-Q01).
 

Research Areas for GOLM1 Partial Recombinant Protein (H00051280-Q01)

Find related products by research area.

Blogs on GOLM1.

6 Fictional Character Protein Names
Check out our list of some of the funniest fictional character protein names including GOLM1, SMURF1, HOMER1, Hunchback, Lilliputian, Pokemon, Tinman Paralog, and Draculin. What are your favorite or funniest protein names? Share them in the comments;...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GOLM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLM1