Golgin A6 Family-Like 2 Antibody

Images

 
Immunohistochemistry: Golgin A6 Family-Like 2 Antibody [NBP2-30781] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Product Discontinued
View other related Golgin A6 Family-Like 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-30781
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Golgin A6 Family-Like 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TAQEIMQLFCGMKNAQQCPGLGSTSCIPFFYRGDKRKMKIINI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLGA6L2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Golgin A6 Family-Like 2 Antibody

  • Cancer/Testis Antigen 105
  • CT105
  • GOLGA6L2
  • Golgi Autoantigen, Golgin Subfamily A, 6-Like 2
  • Golgin Subfamily A Member 6-Like Protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
NBP2-32157
Species: Hu
Applications: WB, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00055777-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30781
Species: Hu
Applications: IHC, IHC-P

Publications for Golgin A6 Family-Like 2 Antibody (NBP2-30781) (0)

There are no publications for Golgin A6 Family-Like 2 Antibody (NBP2-30781).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Golgin A6 Family-Like 2 Antibody (NBP2-30781) (0)

There are no reviews for Golgin A6 Family-Like 2 Antibody (NBP2-30781). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Golgin A6 Family-Like 2 Antibody (NBP2-30781) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for Golgin A6 Family-Like 2 Antibody (NBP2-30781)

Discover related pathways, diseases and genes to Golgin A6 Family-Like 2 Antibody (NBP2-30781). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Golgin A6 Family-Like 2 Antibody (NBP2-30781)

Discover more about diseases related to Golgin A6 Family-Like 2 Antibody (NBP2-30781).

Blogs on Golgin A6 Family-Like 2

There are no specific blogs for Golgin A6 Family-Like 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Golgin A6 Family-Like 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA6L2
Uniprot