GOLGA5 Antibody - BSA Free

Western Blot: GOLGA5 Antibody [NBP1-60047] - Human 293T, Antibody Dilution: 1.0 ug/ml GOLGA5 is supported by BioGPS gene expression data to be expressed in HEK293T.

Western Blot: GOLGA5 Antibody [NBP1-60047] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GOLGA5 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GOLGA5(golgi autoantigen, golgin subfamily a, 5) The peptide sequence was selected from the N terminal of GOLGA5. Peptide sequence FVRRKKSEPDDELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVS. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Golgi Apparatus Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GOLGA5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GOLGA5 Antibody - BSA Free

• Cell proliferation-inducing gene 31 protein
• golgi autoantigen, golgin subfamily a, 5
• golgin A5
• Golgin subfamily A member 5
• Golgin-84
• GOLIM5
• Protein Ret-II
• PTC5
• RET-fused gene 5 protein
• RETII
• ret-II
• rfg5
• RFG5golgi integral membrane protein 5

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. GOLGA5 is a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5.The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GOLGA5
• Uniprot:
  • Q8TBA6(Human)