Recombinant Human GnRH Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GnRH Peptides and Proteins

Order Details


    • Catalog Number
      H00002796-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GnRH Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-69 of Human GNRH1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GNRH1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GnRH Protein

  • GNRH
  • GnRH-associated peptide 1
  • gonadotropin-releasing hormone 1 (leutinizing-releasing hormone)
  • gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)
  • GRH
  • LHRH
  • LNRH
  • luliberin I
  • Progonadoliberin I
  • progonadoliberin-1
  • prolactin release-inhibiting factor

Background

GNRH1 - gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC

Publications for GnRH Partial Recombinant Protein (H00002796-Q01) (0)

There are no publications for GnRH Partial Recombinant Protein (H00002796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GnRH Partial Recombinant Protein (H00002796-Q01) (0)

There are no reviews for GnRH Partial Recombinant Protein (H00002796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GnRH Partial Recombinant Protein (H00002796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GnRH Products

Bioinformatics Tool for GnRH Partial Recombinant Protein (H00002796-Q01)

Discover related pathways, diseases and genes to GnRH Partial Recombinant Protein (H00002796-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GnRH Partial Recombinant Protein (H00002796-Q01)

Discover more about diseases related to GnRH Partial Recombinant Protein (H00002796-Q01).
 

Pathways for GnRH Partial Recombinant Protein (H00002796-Q01)

View related products by pathway.

PTMs for GnRH Partial Recombinant Protein (H00002796-Q01)

Learn more about PTMs related to GnRH Partial Recombinant Protein (H00002796-Q01).
 

Research Areas for GnRH Partial Recombinant Protein (H00002796-Q01)

Find related products by research area.

Blogs on GnRH.

The Use of RNA Polymerase II Antibodies In Proteasome Regulation Studies
At Novus Biologicals, we recently added a new RNA Polymerase II antibody (clone 4H8) to our antibody catalog. RNAPII is an essential transcription enzyme, catalyzing the transcription of DNA during the elongation stage of mRNA synthesis (known as the...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GnRH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNRH1