GMF-beta Antibody (2G12-2A2) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related GMF-beta Primary Antibodies

Order Details


    • Catalog Number
      H00002764-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GMF-beta Antibody (2G12-2A2) [DyLight 488] Summary

Immunogen
GMFB (AAH05359, 1 a.a. - 154 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY
Specificity
GMFB - glia maturation factor, beta
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GMFB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GMF-beta Antibody (2G12-2A2) [DyLight 488]

  • glia maturation factor beta
  • glia maturation factor, beta
  • GMF
  • GMFB
  • GMFbeta
  • GMF-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
H00004340-B01P
Species: Hu, Rt
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31367
Species: Hu
Applications: WB, ICC/IF
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00002764-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GMF-beta Antibody (H00002764-M01G) (0)

There are no publications for GMF-beta Antibody (H00002764-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMF-beta Antibody (H00002764-M01G) (0)

There are no reviews for GMF-beta Antibody (H00002764-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMF-beta Antibody (H00002764-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMF-beta Products

Bioinformatics Tool for GMF-beta Antibody (H00002764-M01G)

Discover related pathways, diseases and genes to GMF-beta Antibody (H00002764-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMF-beta Antibody (H00002764-M01G)

Discover more about diseases related to GMF-beta Antibody (H00002764-M01G).
 

Pathways for GMF-beta Antibody (H00002764-M01G)

View related products by pathway.

PTMs for GMF-beta Antibody (H00002764-M01G)

Learn more about PTMs related to GMF-beta Antibody (H00002764-M01G).

Blogs on GMF-beta

There are no specific blogs for GMF-beta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMF-beta Antibody (2G12-2A2) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol GMFB
Entrez