GMEB1 Antibody (2A8) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related GMEB1 Primary Antibodies

Order Details


    • Catalog Number
      H00010691-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GMEB1 Antibody (2A8) [DyLight 488] Summary

Immunogen
GMEB1 (NP_077808, 467 a.a. ~ 564 a.a) partial recombinant protein with GST tag.TAMQDGSTLGNMTTMVSPVELVAMESGLTSAIQAVESTSEDG QTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQ HQVHNVEIVVLED
Localization
Nucleus. Cytoplasm. Note=May be also cytoplasmic.
Specificity
GMEB1 - glucocorticoid modulatory element binding protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GMEB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GMEB1 Antibody (2A8) [DyLight 488]

  • DNA-binding protein p96PIF
  • glucocorticoid modulatory element binding protein 1
  • glucocorticoid modulatory element-binding protein 1
  • GMEB-1
  • P96PIF
  • Parvovirus initiation factor p96
  • PIF p96
  • PIF96

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81421
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-52501
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
H00008175-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00010691-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for GMEB1 Antibody (H00010691-M01G) (0)

There are no publications for GMEB1 Antibody (H00010691-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMEB1 Antibody (H00010691-M01G) (0)

There are no reviews for GMEB1 Antibody (H00010691-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GMEB1 Antibody (H00010691-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMEB1 Products

Bioinformatics Tool for GMEB1 Antibody (H00010691-M01G)

Discover related pathways, diseases and genes to GMEB1 Antibody (H00010691-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GMEB1 Antibody (H00010691-M01G)

Discover more about diseases related to GMEB1 Antibody (H00010691-M01G).
 

Pathways for GMEB1 Antibody (H00010691-M01G)

View related products by pathway.

PTMs for GMEB1 Antibody (H00010691-M01G)

Learn more about PTMs related to GMEB1 Antibody (H00010691-M01G).

Blogs on GMEB1

There are no specific blogs for GMEB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMEB1 Antibody (2A8) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol GMEB1