GM2A Antibody

Images

 
Western Blot: GM2A Antibody [NBP1-55515] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related GM2A Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55515
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GM2A Antibody Summary

Immunogen
Synthetic peptides corresponding to GM2A(GM2 ganglioside activator) The peptide sequence was selected from the N terminal of GM2A. Peptide sequence MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS.
Clonality
Polyclonal
Host
Rabbit
Gene
GM2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GM2A and was validated on Western blot.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GM2A Antibody

  • Cerebroside sulfate activator protein
  • ganglioside GM2 activator
  • GM2 ganglioside activator
  • GM2-AP
  • SAP-3GM2 ganglioside activator protein
  • Shingolipid activator protein 3
  • sphingolipid activator protein 3

Background

This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the gangliosid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
8907-GH
Species: Hu
MAB6237
Species: Hu
Applications: WB, IHC
AF2485
Species: Hu
Applications: WB, IHC, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56700
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00056913-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-47446
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP1-55515
Species: Hu
Applications: WB

Publications for GM2A Antibody (NBP1-55515) (0)

There are no publications for GM2A Antibody (NBP1-55515).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM2A Antibody (NBP1-55515) (0)

There are no reviews for GM2A Antibody (NBP1-55515). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM2A Antibody (NBP1-55515) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM2A Products

Bioinformatics Tool for GM2A Antibody (NBP1-55515)

Discover related pathways, diseases and genes to GM2A Antibody (NBP1-55515). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM2A Antibody (NBP1-55515)

Discover more about diseases related to GM2A Antibody (NBP1-55515).
 

Pathways for GM2A Antibody (NBP1-55515)

View related products by pathway.

PTMs for GM2A Antibody (NBP1-55515)

Learn more about PTMs related to GM2A Antibody (NBP1-55515).

Blogs on GM2A

There are no specific blogs for GM2A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GM2A
Uniprot