GM130/GOLGA2 Antibody (2C6)

Images

 
Western Blot: GM130/GOLGA2 Antibody (2C6) [H00002801-M01] - GOLGA2 monoclonal antibody (M01), clone 2C6. Analysis of GOLGA2 expression in human spleen.
Sandwich ELISA: GM130/GOLGA2 Antibody (2C6) [H00002801-M01] - Detection limit for recombinant GST tagged GOLGA2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GM130/GOLGA2 Antibody (2C6) Summary

Immunogen
GOLGA2 (AAH06381.1, 1 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEV
Marker
Golgi Apparatus Marker
Specificity
GOLGA2 - golgi autoantigen, golgin subfamily a, 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GOLGA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
GM130/GOLGA2 Lysate (NBP2-65274)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM130/GOLGA2 Antibody (2C6)

  • 130 kDa cis-Golgi matrix protein
  • GM130 autoantigen
  • GM130
  • GM130Golgi matrix protein GM130
  • GOLGA2
  • golgi autoantigen, golgin subfamily a, 2
  • golgin A2
  • Golgin subfamily A member 2
  • Golgin-95
  • MGC20672
  • SY11 Protein

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. The golgins are a family of proteins, of which the protein encoded by this gene is a member, that are localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22321
Species: Hu
Applications: WB, IP, IF
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, ICC
NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75545
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83352
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80771
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39027
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002801-M01
Species: Hu
Applications: WB, ELISA

Publications for GM130/GOLGA2 Antibody (H00002801-M01) (0)

There are no publications for GM130/GOLGA2 Antibody (H00002801-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM130/GOLGA2 Antibody (H00002801-M01) (0)

There are no reviews for GM130/GOLGA2 Antibody (H00002801-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM130/GOLGA2 Antibody (H00002801-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GM130/GOLGA2 Antibody (H00002801-M01)

Discover related pathways, diseases and genes to GM130/GOLGA2 Antibody (H00002801-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM130/GOLGA2 Antibody (H00002801-M01)

Discover more about diseases related to GM130/GOLGA2 Antibody (H00002801-M01).
 

Pathways for GM130/GOLGA2 Antibody (H00002801-M01)

View related products by pathway.

PTMs for GM130/GOLGA2 Antibody (H00002801-M01)

Learn more about PTMs related to GM130/GOLGA2 Antibody (H00002801-M01).
 

Research Areas for GM130/GOLGA2 Antibody (H00002801-M01)

Find related products by research area.

Blogs on GM130/GOLGA2

There are no specific blogs for GM130/GOLGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM130/GOLGA2 Antibody (2C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA2
Entrez
OMIM