GM-CSF R alpha Antibody

Images

 
Western Blot: GM-CSF R alpha Antibody [H00001438-B01P] - Analysis of CSF2RA expression in transfected 293T cell line by CSF2RA polyclonal antibody. Lane 1: CSF2RA transfected lysate(44 KDa). Lane 2: Non-transfected ...read more
Flow Cytometry: GM-CSF R alpha Antibody [H00001438-B01P] - Analysis of negative control 293 cells (Black) and CSF2RA expressing 293 cells (Green) using CSF2RA purified mouse polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GM-CSF R alpha Antibody Summary

Immunogen
CSF2RA (NP_006131.2, 1 a.a. - 400 a.a.) full-length human protein. MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Specificity
CSF2RA - colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CSF2RA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Flow Cytometry
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA and FACS analysis.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM-CSF R alpha Antibody

  • CD116 antigen
  • CD116
  • CDw116
  • colony stimulating factor 2 receptor alpha subunit
  • colony stimulating factor 2 receptor, alpha, low-affinity(granulocyte-macrophage)
  • CSF2R
  • CSF2RA
  • CSF2RAX
  • CSF2RAY
  • CSF2RX
  • CSF2RY
  • GM-CSF R alpha
  • GM-CSF receptor alpha subunit
  • GMCSFR alpha
  • GMCSFR
  • GM-CSFRa
  • GM-CSF-R-alpha
  • GMCSFR-alpha
  • GMR
  • GMR-alpha
  • granulocyte-macrophage colony-stimulating factor receptor alpha chain
  • granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  • MGC3848
  • MGC4838

Background

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2988
Species: Mu, Rt
Applications: WB
DDX0300P-100
Species: Hu, Ca
Applications: Flow, IHC, IHC-Fr, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
H00001438-B01P
Species: Hu
Applications: WB, Flow

Publications for GM-CSF R alpha Antibody (H00001438-B01P) (0)

There are no publications for GM-CSF R alpha Antibody (H00001438-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM-CSF R alpha Antibody (H00001438-B01P) (0)

There are no reviews for GM-CSF R alpha Antibody (H00001438-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM-CSF R alpha Antibody (H00001438-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM-CSF R alpha Products

Bioinformatics Tool for GM-CSF R alpha Antibody (H00001438-B01P)

Discover related pathways, diseases and genes to GM-CSF R alpha Antibody (H00001438-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM-CSF R alpha Antibody (H00001438-B01P)

Discover more about diseases related to GM-CSF R alpha Antibody (H00001438-B01P).
 

Pathways for GM-CSF R alpha Antibody (H00001438-B01P)

View related products by pathway.

PTMs for GM-CSF R alpha Antibody (H00001438-B01P)

Learn more about PTMs related to GM-CSF R alpha Antibody (H00001438-B01P).
 

Research Areas for GM-CSF R alpha Antibody (H00001438-B01P)

Find related products by research area.

Blogs on GM-CSF R alpha

There are no specific blogs for GM-CSF R alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM-CSF R alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF2RA
Entrez
Uniprot