Glycine Receptor Alpha 1 Antibody (4D6)

Images

 
ELISA: Glycine Receptor Alpha 1 Antibody (4D6) [H00002741-M09] - Detection limit for recombinant GST tagged GLRA1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Glycine Receptor Alpha 1 Primary Antibodies

Order Details


    • Catalog Number
      H00002741-M09
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glycine Receptor Alpha 1 Antibody (4D6) Summary

Immunogen
GLRA1 (NP_000162, 121 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IWKPDLFFANEKGAHFHEITTDNKLLRISRNGNVLYSIRITLTLACPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQEQGAVQVADGLTLPQFILKEE
Specificity
GLRA1 - glycine receptor, alpha 1 (startle disease/hyperekplexia, stiff man syndrome) (4D6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLRA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glycine Receptor Alpha 1 Antibody (4D6)

  • GLRA 1
  • Glycine receptor 48 kDa subunit
  • Glycine receptor strychnine-binding subunit
  • glycine receptor subunit alpha-1
  • glycine receptor, alpha 1 (startle disease/hyperekplexia)
  • glycine receptor, alpha 1
  • MGC138878
  • MGC138879
  • STHE

Background

The inhibitory glycine receptor mediates postsynaptic inhibition in the spinal cord and other regions of the central nervous system. It is a pentameric receptor composed of alpha and beta subunits. The GLRB gene (MIM 138492) encodes the beta subunit of the receptor.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-45808
Species: Hu
Applications: IHC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
MAB7848
Species: Hu
Applications: WB, IHC
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP1-52149
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-191
Species: Hu, Mu, Rt
Applications: WB
H00002741-M09
Species: Hu
Applications: WB, ELISA

Publications for Glycine Receptor Alpha 1 Antibody (H00002741-M09) (0)

There are no publications for Glycine Receptor Alpha 1 Antibody (H00002741-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycine Receptor Alpha 1 Antibody (H00002741-M09) (0)

There are no reviews for Glycine Receptor Alpha 1 Antibody (H00002741-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glycine Receptor Alpha 1 Antibody (H00002741-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycine Receptor Alpha 1 Products

Bioinformatics Tool for Glycine Receptor Alpha 1 Antibody (H00002741-M09)

Discover related pathways, diseases and genes to Glycine Receptor Alpha 1 Antibody (H00002741-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycine Receptor Alpha 1 Antibody (H00002741-M09)

Discover more about diseases related to Glycine Receptor Alpha 1 Antibody (H00002741-M09).
 

Pathways for Glycine Receptor Alpha 1 Antibody (H00002741-M09)

View related products by pathway.

Research Areas for Glycine Receptor Alpha 1 Antibody (H00002741-M09)

Find related products by research area.

Blogs on Glycine Receptor Alpha 1

There are no specific blogs for Glycine Receptor Alpha 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycine Receptor Alpha 1 Antibody (4D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRA1
Entrez
Uniprot