Glutathione S-Transferase pi 1/GSTP1 Antibody

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [H00002950-D01P] - Analysis of GSTP1 expression in mouse liver.

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [H00002950-D01P] - Analysis of GSTP1 expression in HeLa.

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [H00002950-D01P] - Analysis of GSTP1 expression in human kidney.

Western Blot: Glutathione S-Transferase pi 1/GSTP1 Antibody [H00002950-D01P] - Analysis of GSTP1 expression in transfected 293T cell line by GSTP1 polyclonal antibody.Lane 1: GSTP1 transfected lysate(23.30 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Glutathione S-Transferase pi 1/GSTP1 Antibody [H00002950-D01P] - Analysis of protein-protein interactions between GSTP1 and MAPK8. HeLa cells were stained with anti-GSTP1 rabbit purified polyclonal 1:1200 and anti-MAPK8 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

Glutathione S-Transferase pi 1/GSTP1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: GSTP1 (AAH10915.1, 1 a.a. - 210 a.a.) full-length human protein. MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Specificity: GSTP1 - glutathione S-transferase pi,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody

• deafness, X-linked 7
• DFN7
• EC 2.5.1.18
• FAEES3
• fatty acid ethyl ester synthase III
• glutathione S-transferase P
• Glutathione STransferase pi 1
• Glutathione S-Transferase pi 1
• GST class-pi
• GST3DFN7
• GSTP
• GSTP1
• GSTP1-1
• PI

Background

Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-D01P)(1)

Publication using H00002950-D01P

• Okamura T, Antoun G, Keir ST et al. Phosphorylation of Glutathione S-Transferase P1 (GSTP1) by Epidermal Growth Factor Receptor (EGFR) Promotes Formation of the GSTP1-c-Jun N-terminal kinase (JNK) Complex and Suppresses JNK Downstream Signaling and Apoptosis in Brain Tumor Cells. J Biol Chem 2015-10-01 [PMID: 26429914]

Bioinformatics

• Gene Symbol: GSTP1
• Entrez:
  • 2950(Human)
• Uniprot:
  • AAH10915.1(Human)