Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [DyLight 488]

Images

 

Order Details


    • Catalog Number
      H00002950-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [DyLight 488] Summary

Immunogen
GSTP1 (AAH10915, 1 a.a. - 210 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Specificity
GSTP1 - glutathione S-transferase pi
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [DyLight 488]

  • deafness, X-linked 7
  • DFN7
  • EC 2.5.1.18
  • FAEES3
  • fatty acid ethyl ester synthase III
  • glutathione S-transferase P
  • Glutathione STransferase pi 1
  • Glutathione S-Transferase pi 1
  • GST class-pi
  • GST3DFN7
  • GSTP
  • GSTP1
  • GSTP1-1
  • PI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
H00002946-M03
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-35213
Species: Hu
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G) (0)

There are no publications for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G) (0)

There are no reviews for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutathione S-Transferase pi 1/GSTP1 Products

Bioinformatics Tool for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G)

Discover related pathways, diseases and genes to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G)

Discover more about diseases related to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G).
 

Pathways for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G)

View related products by pathway.

PTMs for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G)

Learn more about PTMs related to Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G).
 

Research Areas for Glutathione S-Transferase pi 1/GSTP1 Antibody (H00002950-M01G)

Find related products by research area.

Blogs on Glutathione S-Transferase pi 1/GSTP1

There are no specific blogs for Glutathione S-Transferase pi 1/GSTP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutathione S-Transferase pi 1/GSTP1 Antibody (2G6-F6) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTP1
Entrez