Recombinant Human Glutaredoxin 2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Glutaredoxin 2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-124 of Human GLRX2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GLRX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glutaredoxin 2 Protein

  • bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2)
  • glutaredoxin 2
  • glutaredoxin-2, mitochondrial
  • GRX2bA101E13.1

Background

GLRX2( AAH28113, 1 a.a. - 125 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3119
Species: Mu
Applications: WB
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3254
Species: Hu, Mu, Rt
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NB600-248
Species: Hu
Applications: WB, IP
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
AF7560
Species: Hu, Mu, Rt
Applications: WB
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051022-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Glutaredoxin 2 Recombinant Protein (H00051022-P01) (0)

There are no publications for Glutaredoxin 2 Recombinant Protein (H00051022-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutaredoxin 2 Recombinant Protein (H00051022-P01) (0)

There are no reviews for Glutaredoxin 2 Recombinant Protein (H00051022-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutaredoxin 2 Recombinant Protein (H00051022-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutaredoxin 2 Products

Bioinformatics Tool for Glutaredoxin 2 Recombinant Protein (H00051022-P01)

Discover related pathways, diseases and genes to Glutaredoxin 2 Recombinant Protein (H00051022-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutaredoxin 2 Recombinant Protein (H00051022-P01)

Discover more about diseases related to Glutaredoxin 2 Recombinant Protein (H00051022-P01).
 

Pathways for Glutaredoxin 2 Recombinant Protein (H00051022-P01)

View related products by pathway.

PTMs for Glutaredoxin 2 Recombinant Protein (H00051022-P01)

Learn more about PTMs related to Glutaredoxin 2 Recombinant Protein (H00051022-P01).
 

Research Areas for Glutaredoxin 2 Recombinant Protein (H00051022-P01)

Find related products by research area.

Blogs on Glutaredoxin 2

There are no specific blogs for Glutaredoxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glutaredoxin 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRX2