Glutamine Synthetase Antibody

Images

 
Western Blot: Glutamine Synthetase Antibody [H00002752-D01P] - Analysis of GLUL expression in mouse liver.
Western Blot: Glutamine Synthetase Antibody [H00002752-D01P] - Analysis of GLUL expression in transfected 293T cell line by GLUL polyclonal antibody.Lane 1: GLUL transfected lysate(42.10 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glutamine Synthetase Antibody Summary

Immunogen
GLUL (NP_002056.2, 1 a.a. - 373 a.a.) full-length human protein. MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN
Specificity
GLUL - glutamate-ammonia ligase (glutamine synthetase),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLUL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glutamine Synthetase Antibody

  • cell proliferation-inducing protein 59
  • EC 4.1.1.15
  • EC 6.3.1.2
  • GLNSPIG59
  • Glutamate decarboxylase
  • glutamate-ammonia ligase (glutamine synthase)
  • glutamate-ammonia ligase
  • Glutamate--ammonia ligase
  • glutamine synthase
  • glutamine synthetase
  • GS
  • PIG43
  • proliferation-inducing protein 43

Background

Glutamine is a main source of energy and is involved in cell proliferation, inhibition of apoptosis, and cell signaling (Haberle et al., 2005 [PubMed 16267323]). Fetal glutamine requirements are very high and depend largely on active glutamine synthesis and the release of glutamine into the fetal circulation by the placenta. Glutamine synthetase (EC 6.3.1.2), also called glutamate-ammonia ligase (GLUL), is expressed throughout the body and plays an important role in controlling body pH and in removing ammonia from the circulation. The enzyme clears L-glutamate, the major neurotransmitter in the central nervous system, from neuronal synapses (see references in Clancy et al., 1996 [PubMed 8975719]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
MAB7906
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00002752-D01P
Species: Hu, Mu
Applications: WB

Publications for Glutamine Synthetase Antibody (H00002752-D01P) (0)

There are no publications for Glutamine Synthetase Antibody (H00002752-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamine Synthetase Antibody (H00002752-D01P) (0)

There are no reviews for Glutamine Synthetase Antibody (H00002752-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutamine Synthetase Antibody (H00002752-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glutamine Synthetase Products

Bioinformatics Tool for Glutamine Synthetase Antibody (H00002752-D01P)

Discover related pathways, diseases and genes to Glutamine Synthetase Antibody (H00002752-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamine Synthetase Antibody (H00002752-D01P)

Discover more about diseases related to Glutamine Synthetase Antibody (H00002752-D01P).
 

Pathways for Glutamine Synthetase Antibody (H00002752-D01P)

View related products by pathway.

PTMs for Glutamine Synthetase Antibody (H00002752-D01P)

Learn more about PTMs related to Glutamine Synthetase Antibody (H00002752-D01P).
 

Research Areas for Glutamine Synthetase Antibody (H00002752-D01P)

Find related products by research area.

Blogs on Glutamine Synthetase

There are no specific blogs for Glutamine Synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glutamine Synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLUL
Entrez
Uniprot