Glut5 Antibody


Western Blot: Glucose Transporter GLUT5 Antibody [NBP1-69708] - This Anti-SLC2A5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related Glut5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glut5 Antibody Summary

Synthetic peptides corresponding to SLC2A5(solute carrier family 2 (facilitated glucose/fructose transporter), member 5) The peptide sequence was selected from the middle region of SLC2A5. Peptide sequence ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
Application Notes
This is a rabbit polyclonal antibody against SLC2A5 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Glut5 Antibody

  • Fructose transporter
  • Glucose transporter type 5, small intestine
  • Glut5
  • GLUT-5
  • GLUT5glucose transporter-like protein 5
  • SLC2A5
  • solute carrier family 2 (facilitated glucose transporter), member 5
  • solute carrier family 2 (facilitated glucose/fructose transporter), member 5
  • solute carrier family 2, facilitated glucose transporter member 5


SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Glut5 Antibody (NBP1-69708) (0)

There are no publications for Glut5 Antibody (NBP1-69708).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut5 Antibody (NBP1-69708) (0)

There are no reviews for Glut5 Antibody (NBP1-69708). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glut5 Antibody (NBP1-69708) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glut5 Products

Bioinformatics Tool for Glut5 Antibody (NBP1-69708)

Discover related pathways, diseases and genes to Glut5 Antibody (NBP1-69708). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut5 Antibody (NBP1-69708)

Discover more about diseases related to Glut5 Antibody (NBP1-69708).

Pathways for Glut5 Antibody (NBP1-69708)

View related products by pathway.

PTMs for Glut5 Antibody (NBP1-69708)

Learn more about PTMs related to Glut5 Antibody (NBP1-69708).

Blogs on Glut5

There are no specific blogs for Glut5, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glut5 Antibody and receive a gift card or discount.


Gene Symbol SLC2A5